Lineage for d1i96e1 (1i96 E:74-157)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2176343Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2176344Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2176345Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 2176390Protein Ribosomal protein S5, C-terminal domain [54215] (3 species)
  7. 2176418Species Thermus thermophilus [TaxId:274] [54217] (36 PDB entries)
    Uniprot P27152 ! Uniprot P80373
  8. 2176442Domain d1i96e1: 1i96 E:74-157 [62039]
    Other proteins in same PDB: d1i96b_, d1i96c1, d1i96c2, d1i96d_, d1i96e2, d1i96f_, d1i96g_, d1i96h_, d1i96i_, d1i96j_, d1i96k_, d1i96l_, d1i96m_, d1i96n_, d1i96o_, d1i96p_, d1i96q_, d1i96r_, d1i96s_, d1i96t_, d1i96u_, d1i96v_
    complexed with mg, wo2, zn

Details for d1i96e1

PDB Entry: 1i96 (more details), 4.2 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the translation initiation factor if3 (c-terminal domain)
PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d1i96e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i96e1 d.14.1.1 (E:74-157) Ribosomal protein S5, C-terminal domain {Thermus thermophilus [TaxId: 274]}
gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay
atmealrqlrtkadverlrkgeah

SCOPe Domain Coordinates for d1i96e1:

Click to download the PDB-style file with coordinates for d1i96e1.
(The format of our PDB-style files is described here.)

Timeline for d1i96e1: