![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) ![]() |
![]() | Family d.14.1.1: Translational machinery components [54212] (4 proteins) |
![]() | Protein Ribosomal protein S5, C-terminal domain [54215] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54217] (36 PDB entries) Uniprot P27152 Uniprot P80373 Uniprot P27152 ! Uniprot P80373 |
![]() | Domain d1i96e1: 1i96 E:74-157 [62039] Other proteins in same PDB: d1i96b_, d1i96c1, d1i96c2, d1i96d_, d1i96e2, d1i96f_, d1i96g_, d1i96h_, d1i96i_, d1i96j_, d1i96k_, d1i96l_, d1i96m_, d1i96n_, d1i96o_, d1i96p_, d1i96q_, d1i96r_, d1i96s_, d1i96t_, d1i96u_, d1i96v_ complexed with mg, wo2, zn |
PDB Entry: 1i96 (more details), 4.2 Å
SCOP Domain Sequences for d1i96e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i96e1 d.14.1.1 (E:74-157) Ribosomal protein S5, C-terminal domain {Thermus thermophilus [TaxId: 274]} gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay atmealrqlrtkadverlrkgeah
Timeline for d1i96e1: