Lineage for d1i96d_ (1i96 D:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 81032Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
  4. 81033Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (3 families) (S)
  5. 81038Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein)
  6. 81039Protein Ribosomal protein S4 [55179] (2 species)
  7. 81043Species Thermus thermophilus [TaxId:274] [55180] (10 PDB entries)
  8. 81051Domain d1i96d_: 1i96 D: [62038]
    Other proteins in same PDB: d1i96b_, d1i96c1, d1i96c2, d1i96e1, d1i96e2, d1i96f_, d1i96g_, d1i96h_, d1i96i_, d1i96j_, d1i96k_, d1i96l_, d1i96m_, d1i96n_, d1i96o_, d1i96p_, d1i96q_, d1i96r_, d1i96s_, d1i96t_, d1i96u_, d1i96v_

Details for d1i96d_

PDB Entry: 1i96 (more details), 4.2 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the translation initiation factor if3 (c-terminal domain)

SCOP Domain Sequences for d1i96d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i96d_ d.66.1.2 (D:) Ribosomal protein S4 {Thermus thermophilus}
gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
kgkflrlpdredlalpvneqlviefysr

SCOP Domain Coordinates for d1i96d_:

Click to download the PDB-style file with coordinates for d1i96d_.
(The format of our PDB-style files is described here.)

Timeline for d1i96d_: