Lineage for d1i96c2 (1i96 C:107-207)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191737Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
  4. 191738Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) (S)
  5. 191739Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)
  6. 191740Protein Ribosomal protein S3 C-terminal domain [54823] (1 species)
  7. 191741Species Thermus thermophilus [TaxId:274] [54824] (10 PDB entries)
  8. 191749Domain d1i96c2: 1i96 C:107-207 [62037]
    Other proteins in same PDB: d1i96b_, d1i96c1, d1i96d_, d1i96e1, d1i96e2, d1i96f_, d1i96g_, d1i96h_, d1i96i_, d1i96j_, d1i96k_, d1i96l_, d1i96m_, d1i96n_, d1i96o_, d1i96p_, d1i96q_, d1i96r_, d1i96s_, d1i96t_, d1i96u_, d1i96v_

Details for d1i96c2

PDB Entry: 1i96 (more details), 4.2 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the translation initiation factor if3 (c-terminal domain)

SCOP Domain Sequences for d1i96c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i96c2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

SCOP Domain Coordinates for d1i96c2:

Click to download the PDB-style file with coordinates for d1i96c2.
(The format of our PDB-style files is described here.)

Timeline for d1i96c2: