Lineage for d1i96c1 (1i96 C:2-106)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 133071Fold d.52: Alpha-lytic protease prodomain-like [54805] (3 superfamilies)
  4. 133098Superfamily d.52.3: Prokaryotic type KH domain (pKH-domain) [54814] (1 family) (S)
  5. 133099Family d.52.3.1: Prokaryotic type KH domain (pKH-domain) [54815] (4 proteins)
  6. 133108Protein Ribosomal protein S3 N-terminal domain [54816] (1 species)
  7. 133109Species Thermus thermophilus [TaxId:274] [54817] (10 PDB entries)
  8. 133117Domain d1i96c1: 1i96 C:2-106 [62036]
    Other proteins in same PDB: d1i96b_, d1i96c2, d1i96d_, d1i96e1, d1i96e2, d1i96f_, d1i96g_, d1i96h_, d1i96i_, d1i96j_, d1i96k_, d1i96l_, d1i96m_, d1i96n_, d1i96o_, d1i96p_, d1i96q_, d1i96r_, d1i96s_, d1i96t_, d1i96u_, d1i96v_

Details for d1i96c1

PDB Entry: 1i96 (more details), 4.2 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the translation initiation factor if3 (c-terminal domain)

SCOP Domain Sequences for d1i96c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i96c1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev

SCOP Domain Coordinates for d1i96c1:

Click to download the PDB-style file with coordinates for d1i96c1.
(The format of our PDB-style files is described here.)

Timeline for d1i96c1: