Lineage for d1i96b_ (1i96 B:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 177542Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 178170Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) (S)
  5. 178171Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein)
  6. 178172Protein Ribosomal protein S2 [52315] (1 species)
  7. 178173Species Thermus thermophilus [TaxId:274] [52316] (10 PDB entries)
  8. 178181Domain d1i96b_: 1i96 B: [62035]
    Other proteins in same PDB: d1i96c1, d1i96c2, d1i96d_, d1i96e1, d1i96e2, d1i96f_, d1i96g_, d1i96h_, d1i96i_, d1i96j_, d1i96k_, d1i96l_, d1i96m_, d1i96n_, d1i96o_, d1i96p_, d1i96q_, d1i96r_, d1i96s_, d1i96t_, d1i96u_, d1i96v_

Details for d1i96b_

PDB Entry: 1i96 (more details), 4.2 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the translation initiation factor if3 (c-terminal domain)

SCOP Domain Sequences for d1i96b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i96b_ c.23.15.1 (B:) Ribosomal protein S2 {Thermus thermophilus}
pveitvkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedl
amrggtilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleeleal
faspeieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklf
ipvialadtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvqe
aeatetpeg

SCOP Domain Coordinates for d1i96b_:

Click to download the PDB-style file with coordinates for d1i96b_.
(The format of our PDB-style files is described here.)

Timeline for d1i96b_: