SCOPe 2.02: Domain d1i95s_: 1i95 S:

Lineage for d1i95s_ (1i95 S:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
   alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123

4. Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family)

5. Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)

6. Protein Ribosomal protein S19 [54572] (2 species)

7. Species Thermus thermophilus [TaxId:274] [54573] (38 PDB entries)
   Uniprot P80381

8. Domain d1i95s_: 1i95 S: [62032]
   Other proteins in same PDB: d1i95b_, d1i95c1, d1i95c2, d1i95d_, d1i95e1, d1i95e2, d1i95f_, d1i95g_, d1i95h_, d1i95i_, d1i95j_, d1i95k_, d1i95l_, d1i95m_, d1i95n_, d1i95o_, d1i95p_, d1i95q_, d1i95r_, d1i95t_, d1i95u_
   complexed with ede, mg, wo2, zn

Details for d1i95s_

PDB Entry: 1i95, 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with edeine

PDB Compounds: (S:) 30S ribosomal protein S19

SCOPe Domain Sequences for d1i95s_:

Sequence; same for both SEQRES and ATOM records:

>d1i95s_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

Timeline for d1i95s_:

• d1i95s_ first appeared in SCOP 1.57
  
• d1i95s_ appears in SCOPe 2.01
  
• d1i95s_ appears in SCOPe 2.03
  
• d1i95s_ appears in the current release, SCOPe 2.08