Class a: All alpha proteins [46456] (179 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) |
Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein) |
Protein Ribosomal protein S18 [46913] (1 species) |
Species Thermus thermophilus [TaxId:274] [46914] (15 PDB entries) |
Domain d1i95r_: 1i95 R: [62031] Other proteins in same PDB: d1i95b_, d1i95c1, d1i95c2, d1i95d_, d1i95e1, d1i95e2, d1i95f_, d1i95g_, d1i95h_, d1i95i_, d1i95j_, d1i95k_, d1i95l_, d1i95m_, d1i95n_, d1i95o_, d1i95p_, d1i95q_, d1i95s_, d1i95t_, d1i95u_ complexed with ede, mg, wo2, zn |
PDB Entry: 1i95 (more details), 4.5 Å
SCOP Domain Sequences for d1i95r_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i95r_ a.4.8.1 (R:) Ribosomal protein S18 {Thermus thermophilus} kpkkeaqrrpsrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqril aktikrarilgllpfteklvrk
Timeline for d1i95r_: