Lineage for d1i95n_ (1i95 N:)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 429921Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 429922Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (11 families) (S)
  5. 430070Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)
  6. 430071Protein Ribosomal protein S14 [57753] (1 species)
  7. 430072Species Thermus thermophilus [TaxId:274] [57754] (14 PDB entries)
  8. 430086Domain d1i95n_: 1i95 N: [62027]
    Other proteins in same PDB: d1i95b_, d1i95c1, d1i95c2, d1i95d_, d1i95e1, d1i95e2, d1i95f_, d1i95g_, d1i95h_, d1i95i_, d1i95j_, d1i95k_, d1i95l_, d1i95m_, d1i95o_, d1i95p_, d1i95q_, d1i95r_, d1i95s_, d1i95t_, d1i95u_
    complexed with ede, mg, wo2, zn

Details for d1i95n_

PDB Entry: 1i95 (more details), 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with edeine

SCOP Domain Sequences for d1i95n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i95n_ g.39.1.7 (N:) Ribosomal protein S14 {Thermus thermophilus}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

SCOP Domain Coordinates for d1i95n_:

Click to download the PDB-style file with coordinates for d1i95n_.
(The format of our PDB-style files is described here.)

Timeline for d1i95n_: