SCOP 1.65: Domain d1i95n_: 1i95 N:

Lineage for d1i95n_ (1i95 N:)

1. Root: SCOP 1.65

2. Class g: Small proteins [56992] (66 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (9 families)

5. Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)

6. Protein Ribosomal protein S14 [57753] (1 species)

7. Species Thermus thermophilus [TaxId:274] [57754] (14 PDB entries)

8. Domain d1i95n_: 1i95 N: [62027]
   Other proteins in same PDB: d1i95b_, d1i95c1, d1i95c2, d1i95d_, d1i95e1, d1i95e2, d1i95f_, d1i95g_, d1i95h_, d1i95i_, d1i95j_, d1i95k_, d1i95l_, d1i95m_, d1i95o_, d1i95p_, d1i95q_, d1i95r_, d1i95s_, d1i95t_, d1i95u_
   complexed with ede, mg, wo2, zn

Details for d1i95n_

PDB Entry: 1i95, 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with edeine

SCOP Domain Sequences for d1i95n_:

Sequence; same for both SEQRES and ATOM records:

>d1i95n_ g.39.1.7 (N:) Ribosomal protein S14 {Thermus thermophilus}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

Timeline for d1i95n_:

• d1i95n_ first appeared in SCOP 1.57
  
• d1i95n_ appears in SCOP 1.63
  
• d1i95n_ appears in SCOP 1.67
  
• d1i95n_ appears in the current release, SCOPe 2.08