Class g: Small proteins [56992] (66 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (9 families) |
Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein) |
Protein Ribosomal protein S14 [57753] (1 species) |
Species Thermus thermophilus [TaxId:274] [57754] (14 PDB entries) |
Domain d1i95n_: 1i95 N: [62027] Other proteins in same PDB: d1i95b_, d1i95c1, d1i95c2, d1i95d_, d1i95e1, d1i95e2, d1i95f_, d1i95g_, d1i95h_, d1i95i_, d1i95j_, d1i95k_, d1i95l_, d1i95m_, d1i95o_, d1i95p_, d1i95q_, d1i95r_, d1i95s_, d1i95t_, d1i95u_ complexed with ede, mg, wo2, zn |
PDB Entry: 1i95 (more details), 4.5 Å
SCOP Domain Sequences for d1i95n_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i95n_ g.39.1.7 (N:) Ribosomal protein S14 {Thermus thermophilus} arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw
Timeline for d1i95n_: