SCOP 1.75: Domain d1i95l_: 1i95 L:

Lineage for d1i95l_ (1i95 L:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (30 proteins)
   barrel, closed; n=5, S=8

6. Protein Ribosomal protein S12 [50302] (2 species)

7. Species Thermus thermophilus [TaxId:274] [50303] (36 PDB entries)
   Uniprot P17293

8. Domain d1i95l_: 1i95 L: [62025]
   Other proteins in same PDB: d1i95b_, d1i95c1, d1i95c2, d1i95d_, d1i95e1, d1i95e2, d1i95f_, d1i95g_, d1i95h_, d1i95i_, d1i95j_, d1i95k_, d1i95m_, d1i95n_, d1i95o_, d1i95p_, d1i95q_, d1i95r_, d1i95s_, d1i95t_, d1i95u_
   complexed with ede, mg, wo2, zn

Details for d1i95l_

PDB Entry: 1i95, 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with edeine

PDB Compounds: (L:) 30S ribosomal protein S12

SCOP Domain Sequences for d1i95l_:

Sequence; same for both SEQRES and ATOM records:

>d1i95l_ b.40.4.5 (L:) Ribosomal protein S12 {Thermus thermophilus [TaxId: 274]}
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
pkeaaktaakk

Timeline for d1i95l_:

• d1i95l_ first appeared in SCOP 1.57
  
• d1i95l_ appears in SCOP 1.73
  
• d1i95l_ appears in SCOPe 2.01
  
• d1i95l_ appears in the current release, SCOPe 2.08