Lineage for d1i95h_ (1i95 H:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2584796Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
    consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a
  4. 2584797Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
    automatically mapped to Pfam PF00410
  5. 2584798Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 2584799Protein Ribosomal protein S8 [56049] (4 species)
  7. 2584817Species Thermus thermophilus [TaxId:274] [56051] (46 PDB entries)
    Uniprot P24319
  8. 2584855Domain d1i95h_: 1i95 H: [62021]
    Other proteins in same PDB: d1i95b_, d1i95c1, d1i95c2, d1i95d_, d1i95e1, d1i95e2, d1i95f_, d1i95g_, d1i95i_, d1i95j_, d1i95k_, d1i95l_, d1i95m_, d1i95n_, d1i95o_, d1i95p_, d1i95q_, d1i95r_, d1i95s_, d1i95t_, d1i95u_
    complexed with ede, mg, wo2, zn

Details for d1i95h_

PDB Entry: 1i95 (more details), 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with edeine
PDB Compounds: (H:) 30S ribosomal protein S8

SCOPe Domain Sequences for d1i95h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i95h_ d.140.1.1 (H:) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]}
mltdpiadmltrirnatrvykestevpasrfkeeilkilaregfikgyervevdgkpylr
ihlkygprrqgpdprpeqvikhirrisrpgrrvyvgvkeiprvrrglgiailstpkgvlt
drearklgvggelicevw

SCOPe Domain Coordinates for d1i95h_:

Click to download the PDB-style file with coordinates for d1i95h_.
(The format of our PDB-style files is described here.)

Timeline for d1i95h_: