Lineage for d1i95g_ (1i95 G:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 283267Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 283268Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 283269Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 283270Protein Ribosomal protein S7 [47975] (3 species)
  7. 283275Species Thermus thermophilus [TaxId:274] [47977] (15 PDB entries)
  8. 283289Domain d1i95g_: 1i95 G: [62020]
    Other proteins in same PDB: d1i95b_, d1i95c1, d1i95c2, d1i95d_, d1i95e1, d1i95e2, d1i95f_, d1i95h_, d1i95i_, d1i95j_, d1i95k_, d1i95l_, d1i95m_, d1i95n_, d1i95o_, d1i95p_, d1i95q_, d1i95r_, d1i95s_, d1i95t_, d1i95u_
    complexed with ede, mg, wo2, zn

Details for d1i95g_

PDB Entry: 1i95 (more details), 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with edeine

SCOP Domain Sequences for d1i95g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i95g_ a.75.1.1 (G:) Ribosomal protein S7 {Thermus thermophilus}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

SCOP Domain Coordinates for d1i95g_:

Click to download the PDB-style file with coordinates for d1i95g_.
(The format of our PDB-style files is described here.)

Timeline for d1i95g_: