SCOP 1.59: Domain d1i95f_: 1i95 F:

Lineage for d1i95f_ (1i95 F:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.58: Ferredoxin-like [54861] (39 superfamilies)

4. Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family)

5. Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)

6. Protein Ribosomal protein S6 [54997] (1 species)

7. Species Thermus thermophilus [TaxId:274] [54998] (16 PDB entries)

8. Domain d1i95f_: 1i95 F: [62019]
   Other proteins in same PDB: d1i95b_, d1i95c1, d1i95c2, d1i95d_, d1i95e1, d1i95e2, d1i95g_, d1i95h_, d1i95i_, d1i95j_, d1i95k_, d1i95l_, d1i95m_, d1i95n_, d1i95o_, d1i95p_, d1i95q_, d1i95r_, d1i95s_, d1i95t_, d1i95u_

Details for d1i95f_

PDB Entry: 1i95, 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with edeine

SCOP Domain Sequences for d1i95f_:

Sequence; same for both SEQRES and ATOM records:

>d1i95f_ d.58.14.1 (F:) Ribosomal protein S6 {Thermus thermophilus}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

Timeline for d1i95f_:

• d1i95f_ first appeared in SCOP 1.57
  
• d1i95f_ appears in SCOP 1.61
  
• d1i95f_ appears in the current release, SCOPe 2.08