Lineage for d1i95e1 (1i95 E:74-157)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 130799Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
  4. 130800Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (5 families) (S)
  5. 130801Family d.14.1.1: Translational machinery components [54212] (3 proteins)
  6. 130809Protein Ribosomal protein S5, C-terminal domain [54215] (2 species)
  7. 130812Species Thermus thermophilus [TaxId:274] [54217] (10 PDB entries)
  8. 130822Domain d1i95e1: 1i95 E:74-157 [62017]
    Other proteins in same PDB: d1i95b_, d1i95c1, d1i95c2, d1i95d_, d1i95e2, d1i95f_, d1i95g_, d1i95h_, d1i95i_, d1i95j_, d1i95k_, d1i95l_, d1i95m_, d1i95n_, d1i95o_, d1i95p_, d1i95q_, d1i95r_, d1i95s_, d1i95t_, d1i95u_

Details for d1i95e1

PDB Entry: 1i95 (more details), 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with edeine

SCOP Domain Sequences for d1i95e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i95e1 d.14.1.1 (E:74-157) Ribosomal protein S5, C-terminal domain {Thermus thermophilus}
gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay
atmealrqlrtkadverlrkgeah

SCOP Domain Coordinates for d1i95e1:

Click to download the PDB-style file with coordinates for d1i95e1.
(The format of our PDB-style files is described here.)

Timeline for d1i95e1: