Lineage for d1i95c2 (1i95 C:107-207)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1648947Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
    alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143
  4. 1648948Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) (S)
    automatically mapped to Pfam PF00189
  5. 1648949Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)
  6. 1648950Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)
  7. 1648976Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries)
    Uniprot P80372
  8. Domain d1i95c2: 1i95 C:107-207 [62015]
    Other proteins in same PDB: d1i95b_, d1i95c1, d1i95d_, d1i95e1, d1i95e2, d1i95f_, d1i95g_, d1i95h_, d1i95i_, d1i95j_, d1i95k_, d1i95l_, d1i95m_, d1i95n_, d1i95o_, d1i95p_, d1i95q_, d1i95r_, d1i95s_, d1i95t_, d1i95u_
    complexed with ede, mg, wo2, zn

Details for d1i95c2

PDB Entry: 1i95 (more details), 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with edeine
PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d1i95c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i95c2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

SCOPe Domain Coordinates for d1i95c2:

Click to download the PDB-style file with coordinates for d1i95c2.
(The format of our PDB-style files is described here.)

Timeline for d1i95c2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i95c1