SCOP 1.73: Domain d1i94t_: 1i94 T:

Lineage for d1i94t_ (1i94 T:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.7: Spectrin repeat-like [46965] (15 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family)

5. Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
   this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain

6. Protein Ribosomal protein S20 [46994] (1 species)

7. Species Thermus thermophilus [TaxId:274] [46995] (36 PDB entries)

8. Domain d1i94t_: 1i94 T: [62011]
   Other proteins in same PDB: d1i94b_, d1i94c1, d1i94c2, d1i94d_, d1i94e1, d1i94e2, d1i94f_, d1i94g_, d1i94h_, d1i94i_, d1i94j_, d1i94k_, d1i94l_, d1i94m_, d1i94n_, d1i94o_, d1i94p_, d1i94q_, d1i94r_, d1i94s_, d1i94u_
   complexed with mg, wo2, zn

Details for d1i94t_

PDB Entry: 1i94, 3.2 Å

PDB Description: crystal structures of the small ribosomal subunit with tetracycline, edeine and if3

PDB Compounds: (T:) 30S ribosomal protein S20

SCOP Domain Sequences for d1i94t_:

Sequence; same for both SEQRES and ATOM records:

>d1i94t_ a.7.6.1 (T:) Ribosomal protein S20 {Thermus thermophilus [TaxId: 274]}
rnlsalkrhrqslkrrlrnkakksaiktlskkaiqlaqegkaeealkimrkaeslidkaa
kgstlhknaaarrksrlmrkvrqlleaagapliggglsa

Timeline for d1i94t_:

• d1i94t_ first appeared in SCOP 1.57
  
• d1i94t_ appears in SCOP 1.71
  
• d1i94t_ appears in SCOP 1.75
  
• d1i94t_ appears in the current release, SCOPe 2.08