Class a: All alpha proteins [46456] (290 folds) |
Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) automatically mapped to Pfam PF01649 |
Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein) this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain |
Protein Ribosomal protein S20 [46994] (2 species) |
Species Thermus thermophilus [TaxId:274] [46995] (45 PDB entries) Uniprot P80380 |
Domain d1i94t_: 1i94 T: [62011] Other proteins in same PDB: d1i94b_, d1i94c1, d1i94c2, d1i94d_, d1i94e1, d1i94e2, d1i94f_, d1i94g_, d1i94h_, d1i94i_, d1i94j_, d1i94k_, d1i94l_, d1i94m_, d1i94n_, d1i94o_, d1i94p_, d1i94q_, d1i94r_, d1i94s_, d1i94u_ complexed with mg, wo2, zn |
PDB Entry: 1i94 (more details), 3.2 Å
SCOPe Domain Sequences for d1i94t_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i94t_ a.7.6.1 (T:) Ribosomal protein S20 {Thermus thermophilus [TaxId: 274]} rnlsalkrhrqslkrrlrnkakksaiktlskkaiqlaqegkaeealkimrkaeslidkaa kgstlhknaaarrksrlmrkvrqlleaagapliggglsa
Timeline for d1i94t_: