Lineage for d1i94s_ (1i94 S:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720813Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
    alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123
  4. 720814Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) (S)
  5. 720815Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)
  6. 720816Protein Ribosomal protein S19 [54572] (1 species)
  7. 720817Species Thermus thermophilus [TaxId:274] [54573] (38 PDB entries)
  8. 720826Domain d1i94s_: 1i94 S: [62010]
    Other proteins in same PDB: d1i94b_, d1i94c1, d1i94c2, d1i94d_, d1i94e1, d1i94e2, d1i94f_, d1i94g_, d1i94h_, d1i94i_, d1i94j_, d1i94k_, d1i94l_, d1i94m_, d1i94n_, d1i94o_, d1i94p_, d1i94q_, d1i94r_, d1i94t_, d1i94u_
    complexed with mg, wo2, zn

Details for d1i94s_

PDB Entry: 1i94 (more details), 3.2 Å

PDB Description: crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
PDB Compounds: (S:) 30S ribosomal protein S19

SCOP Domain Sequences for d1i94s_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i94s_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

SCOP Domain Coordinates for d1i94s_:

Click to download the PDB-style file with coordinates for d1i94s_.
(The format of our PDB-style files is described here.)

Timeline for d1i94s_: