SCOPe 2.07: Domain d1i94q_: 1i94 Q:

Lineage for d1i94q_ (1i94 Q:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins)
   barrel, closed; n=5, S=8

6. Protein Ribosomal protein S17 [50304] (3 species)

7. Species Thermus thermophilus [TaxId:274] [50305] (45 PDB entries)
   Uniprot P24321

8. Domain d1i94q_: 1i94 Q: [62008]
   Other proteins in same PDB: d1i94b_, d1i94c1, d1i94c2, d1i94d_, d1i94e1, d1i94e2, d1i94f_, d1i94g_, d1i94h_, d1i94i_, d1i94j_, d1i94k_, d1i94l_, d1i94m_, d1i94n_, d1i94o_, d1i94p_, d1i94r_, d1i94s_, d1i94t_, d1i94u_
   complexed with mg, wo2, zn

Details for d1i94q_

PDB Entry: 1i94, 3.2 Å

PDB Description: crystal structures of the small ribosomal subunit with tetracycline, edeine and if3

PDB Compounds: (Q:) 30S ribosomal protein S17

SCOPe Domain Sequences for d1i94q_:

Sequence; same for both SEQRES and ATOM records:

>d1i94q_ b.40.4.5 (Q:) Ribosomal protein S17 {Thermus thermophilus [TaxId: 274]}
pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeerykvgdvveiie
arpiskrkrfrvlrlveegrldlvekylvrrqnyaslskrggka

Timeline for d1i94q_:

• d1i94q_ first appeared in SCOP 1.57
  
• d1i94q_ appears in SCOPe 2.06
  
• d1i94q_ appears in the current release, SCOPe 2.08