Lineage for d1i94p_ (1i94 P:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 410273Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
    beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234
  4. 410274Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 410275Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 410276Protein Ribosomal protein S16 [54567] (1 species)
  7. 410277Species Thermus thermophilus [TaxId:274] [54568] (15 PDB entries)
  8. 410281Domain d1i94p_: 1i94 P: [62007]
    Other proteins in same PDB: d1i94b_, d1i94c1, d1i94c2, d1i94d_, d1i94e1, d1i94e2, d1i94f_, d1i94g_, d1i94h_, d1i94i_, d1i94j_, d1i94k_, d1i94l_, d1i94m_, d1i94n_, d1i94o_, d1i94q_, d1i94r_, d1i94s_, d1i94t_, d1i94u_
    complexed with mg, wo2, zn

Details for d1i94p_

PDB Entry: 1i94 (more details), 3.2 Å

PDB Description: crystal structures of the small ribosomal subunit with tetracycline, edeine and if3

SCOP Domain Sequences for d1i94p_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i94p_ d.27.1.1 (P:) Ribosomal protein S16 {Thermus thermophilus}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqearega

SCOP Domain Coordinates for d1i94p_:

Click to download the PDB-style file with coordinates for d1i94p_.
(The format of our PDB-style files is described here.)

Timeline for d1i94p_: