Class g: Small proteins [56992] (72 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (11 families) |
Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein) |
Protein Ribosomal protein S14 [57753] (1 species) |
Species Thermus thermophilus [TaxId:274] [57754] (14 PDB entries) |
Domain d1i94n_: 1i94 N: [62005] Other proteins in same PDB: d1i94b_, d1i94c1, d1i94c2, d1i94d_, d1i94e1, d1i94e2, d1i94f_, d1i94g_, d1i94h_, d1i94i_, d1i94j_, d1i94k_, d1i94l_, d1i94m_, d1i94o_, d1i94p_, d1i94q_, d1i94r_, d1i94s_, d1i94t_, d1i94u_ complexed with mg, wo2, zn |
PDB Entry: 1i94 (more details), 3.2 Å
SCOP Domain Sequences for d1i94n_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i94n_ g.39.1.7 (N:) Ribosomal protein S14 {Thermus thermophilus} arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw
Timeline for d1i94n_: