Class a: All alpha proteins [46456] (202 folds) |
Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) contains a helix-two turns-helix (H2TH) motif |
Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein) contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension |
Protein Ribosomal protein S13 [46948] (1 species) |
Species Thermus thermophilus [TaxId:274] [46949] (14 PDB entries) |
Domain d1i94m_: 1i94 M: [62004] Other proteins in same PDB: d1i94b_, d1i94c1, d1i94c2, d1i94d_, d1i94e1, d1i94e2, d1i94f_, d1i94g_, d1i94h_, d1i94i_, d1i94j_, d1i94k_, d1i94l_, d1i94n_, d1i94o_, d1i94p_, d1i94q_, d1i94r_, d1i94s_, d1i94t_, d1i94u_ complexed with mg, wo2, zn |
PDB Entry: 1i94 (more details), 3.2 Å
SCOP Domain Sequences for d1i94m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i94m_ a.156.1.1 (M:) Ribosomal protein S13 {Thermus thermophilus} ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve ntwklegelraevaanikrlmdigcyrglrhrr
Timeline for d1i94m_: