SCOPe 2.02: Domain d1i94k_: 1i94 K:

Lineage for d1i94k_ (1i94 K:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.4: Translational machinery components [53137] (2 families)

5. Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)

6. Protein Ribosomal protein S11 [53141] (2 species)

7. Species Thermus thermophilus [TaxId:274] [53142] (46 PDB entries)
   Uniprot P80376

8. Domain d1i94k_: 1i94 K: [62002]
   Other proteins in same PDB: d1i94b_, d1i94c1, d1i94c2, d1i94d_, d1i94e1, d1i94e2, d1i94f_, d1i94g_, d1i94h_, d1i94i_, d1i94j_, d1i94l_, d1i94m_, d1i94n_, d1i94o_, d1i94p_, d1i94q_, d1i94r_, d1i94s_, d1i94t_, d1i94u_
   complexed with mg, wo2, zn

Details for d1i94k_

PDB Entry: 1i94, 3.2 Å

PDB Description: crystal structures of the small ribosomal subunit with tetracycline, edeine and if3

PDB Compounds: (K:) 30S ribosomal protein S11

SCOPe Domain Sequences for d1i94k_:

Sequence; same for both SEQRES and ATOM records:

>d1i94k_ c.55.4.1 (K:) Ribosomal protein S11 {Thermus thermophilus [TaxId: 274]}
kkkvkrqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaal
daakkamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfr
kas

Timeline for d1i94k_:

• d1i94k_ first appeared in SCOP 1.57
  
• d1i94k_ appears in SCOPe 2.01
  
• d1i94k_ appears in SCOPe 2.03
  
• d1i94k_ appears in the current release, SCOPe 2.08