SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1i94k_ (1i94 K:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2125117Superfamily c.55.4: Translational machinery components [53137] (3 families) (S)
  5. 2125118Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 protein domains)
  6. 2125208Protein Ribosomal protein S11 [53141] (2 species)
  7. 2125234Species Thermus thermophilus [TaxId:274] [53142] (46 PDB entries)
    Uniprot P80376
  8. 2125250Domain d1i94k_: 1i94 K: [62002]
    Other proteins in same PDB: d1i94b_, d1i94c1, d1i94c2, d1i94d_, d1i94e1, d1i94e2, d1i94f_, d1i94g_, d1i94h_, d1i94i_, d1i94j_, d1i94l_, d1i94m_, d1i94n_, d1i94o_, d1i94p_, d1i94q_, d1i94r_, d1i94s_, d1i94t_, d1i94u_
    complexed with mg, wo2, zn

Details for d1i94k_

PDB Entry: 1i94 (more details), 3.2 Å

PDB Description: crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
PDB Compounds: (K:) 30S ribosomal protein S11

SCOPe Domain Sequences for d1i94k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i94k_ c.55.4.1 (K:) Ribosomal protein S11 {Thermus thermophilus [TaxId: 274]}
kkkvkrqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaal
daakkamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfr
kas

SCOPe Domain Coordinates for d1i94k_:

Click to download the PDB-style file with coordinates for d1i94k_.
(The format of our PDB-style files is described here.)

Timeline for d1i94k_: