Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.58: Ferredoxin-like [54861] (49 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) |
Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein) |
Protein Ribosomal protein S10 [55001] (1 species) |
Species Thermus thermophilus [TaxId:274] [55002] (14 PDB entries) |
Domain d1i94j_: 1i94 J: [62001] Other proteins in same PDB: d1i94b_, d1i94c1, d1i94c2, d1i94d_, d1i94e1, d1i94e2, d1i94f_, d1i94g_, d1i94h_, d1i94i_, d1i94k_, d1i94l_, d1i94m_, d1i94n_, d1i94o_, d1i94p_, d1i94q_, d1i94r_, d1i94s_, d1i94t_, d1i94u_ |
PDB Entry: 1i94 (more details), 3.2 Å
SCOP Domain Sequences for d1i94j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i94j_ d.58.15.1 (J:) Ribosomal protein S10 {Thermus thermophilus} kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh felrthnrlvdiinpnrktieqlmtldlptgveieikt
Timeline for d1i94j_: