Lineage for d1i94j_ (1i94 J:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 257061Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 257773Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) (S)
  5. 257774Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)
  6. 257775Protein Ribosomal protein S10 [55001] (1 species)
  7. 257776Species Thermus thermophilus [TaxId:274] [55002] (14 PDB entries)
  8. 257783Domain d1i94j_: 1i94 J: [62001]
    Other proteins in same PDB: d1i94b_, d1i94c1, d1i94c2, d1i94d_, d1i94e1, d1i94e2, d1i94f_, d1i94g_, d1i94h_, d1i94i_, d1i94k_, d1i94l_, d1i94m_, d1i94n_, d1i94o_, d1i94p_, d1i94q_, d1i94r_, d1i94s_, d1i94t_, d1i94u_
    complexed with mg, wo2, zn

Details for d1i94j_

PDB Entry: 1i94 (more details), 3.2 Å

PDB Description: crystal structures of the small ribosomal subunit with tetracycline, edeine and if3

SCOP Domain Sequences for d1i94j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i94j_ d.58.15.1 (J:) Ribosomal protein S10 {Thermus thermophilus}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

SCOP Domain Coordinates for d1i94j_:

Click to download the PDB-style file with coordinates for d1i94j_.
(The format of our PDB-style files is described here.)

Timeline for d1i94j_: