Lineage for d1i94g_ (1i94 G:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1740240Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 1740241Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 1740242Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 1740243Protein Ribosomal protein S7 [47975] (4 species)
  7. 1740273Species Thermus thermophilus [TaxId:274] [47977] (47 PDB entries)
    Uniprot P17291
  8. 1740291Domain d1i94g_: 1i94 G: [61998]
    Other proteins in same PDB: d1i94b_, d1i94c1, d1i94c2, d1i94d_, d1i94e1, d1i94e2, d1i94f_, d1i94h_, d1i94i_, d1i94j_, d1i94k_, d1i94l_, d1i94m_, d1i94n_, d1i94o_, d1i94p_, d1i94q_, d1i94r_, d1i94s_, d1i94t_, d1i94u_
    complexed with mg, wo2, zn

Details for d1i94g_

PDB Entry: 1i94 (more details), 3.2 Å

PDB Description: crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
PDB Compounds: (G:) 30S ribosomal protein S7

SCOPe Domain Sequences for d1i94g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i94g_ a.75.1.1 (G:) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

SCOPe Domain Coordinates for d1i94g_:

Click to download the PDB-style file with coordinates for d1i94g_.
(The format of our PDB-style files is described here.)

Timeline for d1i94g_: