Lineage for d1i94f_ (1i94 F:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1206291Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 1206292Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 1206293Protein Ribosomal protein S6 [54997] (4 species)
  7. 1206323Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries)
    Uniprot P23370
  8. 1206347Domain d1i94f_: 1i94 F: [61997]
    Other proteins in same PDB: d1i94b_, d1i94c1, d1i94c2, d1i94d_, d1i94e1, d1i94e2, d1i94g_, d1i94h_, d1i94i_, d1i94j_, d1i94k_, d1i94l_, d1i94m_, d1i94n_, d1i94o_, d1i94p_, d1i94q_, d1i94r_, d1i94s_, d1i94t_, d1i94u_
    complexed with mg, wo2, zn

Details for d1i94f_

PDB Entry: 1i94 (more details), 3.2 Å

PDB Description: crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
PDB Compounds: (F:) 30S ribosomal protein S6

SCOPe Domain Sequences for d1i94f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i94f_ d.58.14.1 (F:) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

SCOPe Domain Coordinates for d1i94f_:

Click to download the PDB-style file with coordinates for d1i94f_.
(The format of our PDB-style files is described here.)

Timeline for d1i94f_: