Lineage for d1i92a_ (1i92 A:)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.36: PDZ domain-like [50155] (1 superfamily) Superfamily b.36.1: PDZ domain-like [50156] (2 families) 
Family b.36.1.1: PDZ domain [50157] (9 proteins) 
Protein Na+/H+ exchanger regulatory factor, NHERF [63754] (1 species) Species Human (Homo sapiens) [TaxId:9606] [63755] (2 PDB entries) 
Domain d1i92a_: 1i92 A: [61990]
Details for d1i92a_
PDB Entry: 1i92 (more details), 1.7 Å
PDB Description: structural basis of the nherf pdz1-cftr interaction
SCOP Domain Sequences for d1i92a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i92a_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens)}
gmlprlcclekgpngygfhlhgekgklgqyirlvepgspaekagllagdrlvevngenve
kethqqvvsriraalnavrllvvdpeqdtrl
SCOP Domain Coordinates for d1i92a_:
Click to download the PDB-style file with coordinates for d1i92a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i92a_:
- d1i92a_ is new in SCOP 1.57
- d1i92a_ appears in SCOP 1.59
- d1i92a_ appears in the current release, SCOPe 2.08, called d1i92a1
View in 3D