Lineage for d1i92a1 (1i92 A:11-94)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2785885Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2786003Protein Na+/H+ exchanger regulatory factor, NHERF [63754] (1 species)
  7. 2786004Species Human (Homo sapiens) [TaxId:9606] [63755] (4 PDB entries)
  8. 2786006Domain d1i92a1: 1i92 A:11-94 [61990]
    Other proteins in same PDB: d1i92a2, d1i92a3
    first PDZ domain
    complexed with cl

Details for d1i92a1

PDB Entry: 1i92 (more details), 1.7 Å

PDB Description: structural basis of the nherf pdz1-cftr interaction
PDB Compounds: (A:) na+/h+ exchange regulatory co-factor

SCOPe Domain Sequences for d1i92a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i92a1 b.36.1.1 (A:11-94) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]}
lprlcclekgpngygfhlhgekgklgqyirlvepgspaekagllagdrlvevngenveke
thqqvvsriraalnavrllvvdpe

SCOPe Domain Coordinates for d1i92a1:

Click to download the PDB-style file with coordinates for d1i92a1.
(The format of our PDB-style files is described here.)

Timeline for d1i92a1: