| Class b: All beta proteins [48724] (180 folds) |
| Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) ![]() peptide-binding domain |
| Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
| Protein Na+/H+ exchanger regulatory factor, NHERF [63754] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [63755] (4 PDB entries) |
| Domain d1i92a1: 1i92 A:11-94 [61990] Other proteins in same PDB: d1i92a2, d1i92a3 first PDZ domain complexed with cl |
PDB Entry: 1i92 (more details), 1.7 Å
SCOPe Domain Sequences for d1i92a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i92a1 b.36.1.1 (A:11-94) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]}
lprlcclekgpngygfhlhgekgklgqyirlvepgspaekagllagdrlvevngenveke
thqqvvsriraalnavrllvvdpe
Timeline for d1i92a1: