SCOP 1.71: Domain d1i8vb_: 1i8v B:

Lineage for d1i8vb_ (1i8v B:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (3 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (5 proteins)

6. Protein RNase Sa [53935] (1 species)

7. Species Streptomyces aureofaciens [TaxId:1894] [53936] (22 PDB entries)

8. Domain d1i8vb_: 1i8v B: [61986]
   complexed with sul; mutant

Details for d1i8vb_

PDB Entry: 1i8v, 1.25 Å

PDB Description: crystal structure of rnase sa y80f mutant

SCOP Domain Sequences for d1i8vb_:

Sequence; same for both SEQRES and ATOM records:

>d1i8vb_ d.1.1.2 (B:) RNase Sa {Streptomyces aureofaciens}
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriitgeatqedfytgdhyatfslidqtc

Timeline for d1i8vb_:

• d1i8vb_ first appeared in SCOP 1.57
  
• d1i8vb_ appears in SCOP 1.69
  
• d1i8vb_ appears in SCOP 1.73
  
• d1i8vb_ appears in the current release, SCOPe 2.08