SCOP 1.59: Domain d1i8pc_: 1i8p C:

Lineage for d1i8pc_ (1i8p C:)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)

4. Superfamily a.3.1: Cytochrome c [46626] (7 families)

5. Family a.3.1.1: monodomain cytochrome c [46627] (13 proteins)

6. Protein Cytochrome c2 [46650] (8 species)

7. Species Rhodopseudomonas palustris [TaxId:1076] [46655] (4 PDB entries)

8. Domain d1i8pc_: 1i8p C: [61982]

Details for d1i8pc_

PDB Entry: 1i8p, 1.95 Å

PDB Description: structure determination of the ferrocytochrome c2 from rhodopseudomonas palustris

SCOP Domain Sequences for d1i8pc_:

Sequence; same for both SEQRES and ATOM records:

>d1i8pc_ a.3.1.1 (C:) Cytochrome c2 {Rhodopseudomonas palustris}
edakageavfkqcmtchradknmvgpalagvvgrkagtaagftysplnhnsgeaglvwta
dnivpyladpnaflkkfltekgkadqavgvtkmtfklaneqqrkdvvaylatlk

Timeline for d1i8pc_:

• d1i8pc_ first appeared in SCOP 1.57
  
• d1i8pc_ appears in SCOP 1.61
  
• d1i8pc_ appears in the current release, SCOPe 2.08