SCOPe 2.06: Domain d1i8pa_: 1i8p A:

Lineage for d1i8pa_ (1i8p A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Cytochrome c2 [46650] (8 species)

7. Species Rhodopseudomonas palustris [TaxId:1076] [46655] (4 PDB entries)

8. Domain d1i8pa_: 1i8p A: [61980]
   complexed with hec

Details for d1i8pa_

PDB Entry: 1i8p, 1.95 Å

PDB Description: structure determination of the ferrocytochrome c2 from rhodopseudomonas palustris

PDB Compounds: (A:) cytochrome c2

SCOPe Domain Sequences for d1i8pa_:

Sequence; same for both SEQRES and ATOM records:

>d1i8pa_ a.3.1.1 (A:) Cytochrome c2 {Rhodopseudomonas palustris [TaxId: 1076]}
edakageavfkqcmtchradknmvgpalagvvgrkagtaagftysplnhnsgeaglvwta
dnivpyladpnaflkkfltekgkadqavgvtkmtfklaneqqrkdvvaylatlk

Timeline for d1i8pa_:

• d1i8pa_ first appeared in SCOP 1.57
  
• d1i8pa_ appears in SCOPe 2.05
  
• d1i8pa_ appears in SCOPe 2.07
  
• d1i8pa_ appears in the current release, SCOPe 2.08