Lineage for d1i8lc_ (1i8l C:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 103162Protein Immunoreceptor CTLA-4 (CD152), N-terminal fragment [48939] (2 species)
  7. 103163Species Human (Homo sapiens) [TaxId:9606] [48940] (3 PDB entries)
  8. 103164Domain d1i8lc_: 1i8l C: [61974]
    Other proteins in same PDB: d1i8la1, d1i8la2, d1i8lb1, d1i8lb2

Details for d1i8lc_

PDB Entry: 1i8l (more details), 3 Å

PDB Description: human b7-1/ctla-4 co-stimulatory complex

SCOP Domain Sequences for d1i8lc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i8lc_ b.1.1.1 (C:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Human (Homo sapiens)}
mhvaqpavvlassrgiasfvceyaspgkatevrvtvlrqadsqvtevcaatymmgneltf
lddsictgtssgnqvnltiqglramdtglyickvelmypppyylgigngaqiyvidpe

SCOP Domain Coordinates for d1i8lc_:

Click to download the PDB-style file with coordinates for d1i8lc_.
(The format of our PDB-style files is described here.)

Timeline for d1i8lc_: