SCOP 1.75: Domain d1i8lb1: 1i8l B:1-105

Lineage for d1i8lb1 (1i8l B:1-105)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein CD80, N-terminal domain [48745] (1 species)
   a soluble form of b7-1

7. Species Human (Homo sapiens) [TaxId:9606] [48746] (2 PDB entries)

8. Domain d1i8lb1: 1i8l B:1-105 [61972]
   Other proteins in same PDB: d1i8la2, d1i8lb2, d1i8lc_, d1i8ld_
   ctla-4 co-stimulatory complex
   complexed with man, nag

Details for d1i8lb1

PDB Entry: 1i8l, 3 Å

PDB Description: human b7-1/ctla-4 co-stimulatory complex

PDB Compounds: (B:) t lymphocyte activation antigen cd80

SCOP Domain Sequences for d1i8lb1:

Sequence; same for both SEQRES and ATOM records:

>d1i8lb1 b.1.1.1 (B:1-105) CD80, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vihvtkevkevatlscghnvsveelaqtriywqkekkmvltmmsgdmniwpeyknrtifd
itnnlsivilalrpsdegtyecvvlkyekdafkrehlaevtlsvk

Timeline for d1i8lb1:

• d1i8lb1 first appeared in SCOP 1.57
  
• d1i8lb1 appears in SCOP 1.73
  
• d1i8lb1 appears in SCOPe 2.01
  
• d1i8lb1 appears in the current release, SCOPe 2.08