Lineage for d1i8jb_ (1i8j B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 475345Superfamily c.1.10: Aldolase [51569] (6 families) (S)
    Common fold covers whole protein structure
  5. 475641Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (1 protein)
    hybrid of classes I and II aldolase
  6. 475642Protein 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51595] (5 species)
  7. 475655Species Escherichia coli [TaxId:562] [51598] (4 PDB entries)
  8. 475660Domain d1i8jb_: 1i8j B: [61969]

Details for d1i8jb_

PDB Entry: 1i8j (more details), 1.9 Å

PDB Description: crystal structure of porphobilinogen synthase complexed with the inhibitor 4,7-dioxosebacic acid

SCOP Domain Sequences for d1i8jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i8jb_ c.1.10.3 (B:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Escherichia coli}
tdliqrprrlrkspalramfeettlslndlvlpifveeeiddykaveampgvmripekhl
areierianagirsvmtfgishhtdetgsdawredglvarmsrickqtvpemivmsdtcf
ceytshghcgvlcehgvdndatlenlgkqavvaaaagadfiapsaamdgqvqairqalda
agfkdtaimsystkfassfygpfreaagsalkgdrksyqmnpmnrreaireslldeaqga
dclmvkpagayldivrelrertelpigayqvsgeyamikfaalagaideekvvleslgsi
kragadlifsyfaldlaekkilr

SCOP Domain Coordinates for d1i8jb_:

Click to download the PDB-style file with coordinates for d1i8jb_.
(The format of our PDB-style files is described here.)

Timeline for d1i8jb_: