SCOPe 2.08: Domain d1i8jb_: 1i8j B:

Lineage for d1i8jb_ (1i8j B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (2 proteins)
   hybrid of classes I and II aldolase
   automatically mapped to Pfam PF00490

6. Protein 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51595] (5 species)

7. Species Escherichia coli [TaxId:562] [51598] (4 PDB entries)

8. Domain d1i8jb_: 1i8j B: [61969]
   complexed with dsb, mg, zn

Details for d1i8jb_

PDB Entry: 1i8j, 1.9 Å

PDB Description: crystal structure of porphobilinogen synthase complexed with the inhibitor 4,7-dioxosebacic acid

PDB Compounds: (B:) porphobilinogen synthase

SCOPe Domain Sequences for d1i8jb_:

Sequence; same for both SEQRES and ATOM records:

>d1i8jb_ c.1.10.3 (B:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Escherichia coli [TaxId: 562]}
tdliqrprrlrkspalramfeettlslndlvlpifveeeiddykaveampgvmripekhl
areierianagirsvmtfgishhtdetgsdawredglvarmsrickqtvpemivmsdtcf
ceytshghcgvlcehgvdndatlenlgkqavvaaaagadfiapsaamdgqvqairqalda
agfkdtaimsystkfassfygpfreaagsalkgdrksyqmnpmnrreaireslldeaqga
dclmvkpagayldivrelrertelpigayqvsgeyamikfaalagaideekvvleslgsi
kragadlifsyfaldlaekkilr

Timeline for d1i8jb_:

• d1i8jb_ first appeared in SCOP 1.57
  
• d1i8jb_ appears in SCOPe 2.07