Lineage for d1i8jb_ (1i8j B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086002Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (2 protein domains)
    hybrid of classes I and II aldolase
    automatically mapped to Pfam PF00490
  6. 2086003Protein 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51595] (5 species)
  7. 2086017Species Escherichia coli [TaxId:562] [51598] (4 PDB entries)
  8. 2086022Domain d1i8jb_: 1i8j B: [61969]
    complexed with dsb, mg, zn

Details for d1i8jb_

PDB Entry: 1i8j (more details), 1.9 Å

PDB Description: crystal structure of porphobilinogen synthase complexed with the inhibitor 4,7-dioxosebacic acid
PDB Compounds: (B:) porphobilinogen synthase

SCOPe Domain Sequences for d1i8jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i8jb_ c.1.10.3 (B:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Escherichia coli [TaxId: 562]}
tdliqrprrlrkspalramfeettlslndlvlpifveeeiddykaveampgvmripekhl
areierianagirsvmtfgishhtdetgsdawredglvarmsrickqtvpemivmsdtcf
ceytshghcgvlcehgvdndatlenlgkqavvaaaagadfiapsaamdgqvqairqalda
agfkdtaimsystkfassfygpfreaagsalkgdrksyqmnpmnrreaireslldeaqga
dclmvkpagayldivrelrertelpigayqvsgeyamikfaalagaideekvvleslgsi
kragadlifsyfaldlaekkilr

SCOPe Domain Coordinates for d1i8jb_:

Click to download the PDB-style file with coordinates for d1i8jb_.
(The format of our PDB-style files is described here.)

Timeline for d1i8jb_: