Lineage for d1i8fa_ (1i8f A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1786638Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1786639Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1786640Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins)
    forms homo and heteroheptameric ring structures
  6. 1786641Protein Archaeal homoheptameric Sm protein [63758] (6 species)
  7. 1786737Species Pyrobaculum aerophilum [TaxId:13773] [63760] (2 PDB entries)
    smap1
  8. 1786738Domain d1i8fa_: 1i8f A: [61959]
    complexed with gol

Details for d1i8fa_

PDB Entry: 1i8f (more details), 1.75 Å

PDB Description: the crystal structure of a heptameric archaeal sm protein: implications for the eukaryotic snrnp core
PDB Compounds: (A:) putative snrnp sm-like protein

SCOPe Domain Sequences for d1i8fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i8fa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Pyrobaculum aerophilum [TaxId: 13773]}
atlgatlqdsigkqvlvklrdsheirgilrsfdqhvnllledaeeiidgnvykrgtmvvr
genvlfispvp

SCOPe Domain Coordinates for d1i8fa_:

Click to download the PDB-style file with coordinates for d1i8fa_.
(The format of our PDB-style files is described here.)

Timeline for d1i8fa_: