Lineage for d1i8dc2 (1i8d C:97-201)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543994Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1544418Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 1544579Family b.43.4.3: Riboflavin synthase [63783] (1 protein)
    duplication: consists of two homologous domains
    automatically mapped to Pfam PF00677
  6. 1544580Protein Riboflavin synthase [63784] (2 species)
    trimerizes via the additional C-terminal helix
  7. 1544581Species Escherichia coli [TaxId:562] [63785] (4 PDB entries)
    Uniprot P29015 1-87
  8. 1544587Domain d1i8dc2: 1i8d C:97-201 [61958]

Details for d1i8dc2

PDB Entry: 1i8d (more details), 2 Å

PDB Description: crystal structure of riboflavin synthase
PDB Compounds: (C:) riboflavin synthase

SCOPe Domain Sequences for d1i8dc2:

Sequence, based on SEQRES records: (download)

>d1i8dc2 b.43.4.3 (C:97-201) Riboflavin synthase {Escherichia coli [TaxId: 562]}
hlmsghimttaevakiltsennrqiwfkvqdsqlmkyilykgfigidgisltvgevtptr
fcvhlipetlerttlgkkklgarvnieidpqtqavvdtvervlaa

Sequence, based on observed residues (ATOM records): (download)

>d1i8dc2 b.43.4.3 (C:97-201) Riboflavin synthase {Escherichia coli [TaxId: 562]}
hlmsghimttaevaiwfkvqdsqlmkyilykgfigidgisltvgevtptrfcvhlipetl
erttlgkkklgarvnieidpqtqavvdtvervlaa

SCOPe Domain Coordinates for d1i8dc2:

Click to download the PDB-style file with coordinates for d1i8dc2.
(The format of our PDB-style files is described here.)

Timeline for d1i8dc2: