Lineage for d1i8db2 (1i8d B:94-206)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 560964Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 561110Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) (S)
  5. 561228Family b.43.4.3: Riboflavin synthase [63783] (1 protein)
    duplication: consists of two homologous domains
  6. 561229Protein Riboflavin synthase [63784] (2 species)
    trimerizes via the additional C-terminal helix
  7. 561230Species Escherichia coli [TaxId:562] [63785] (4 PDB entries)
  8. 561234Domain d1i8db2: 1i8d B:94-206 [61956]

Details for d1i8db2

PDB Entry: 1i8d (more details), 2 Å

PDB Description: crystal structure of riboflavin synthase

SCOP Domain Sequences for d1i8db2:

Sequence, based on SEQRES records: (download)

>d1i8db2 b.43.4.3 (B:94-206) Riboflavin synthase {Escherichia coli}
igghlmsghimttaevakiltsennrqiwfkvqdsqlmkyilykgfigidgisltvgevt
ptrfcvhlipetlerttlgkkklgarvnieidpqtqavvdtvervlaarenam

Sequence, based on observed residues (ATOM records): (download)

>d1i8db2 b.43.4.3 (B:94-206) Riboflavin synthase {Escherichia coli}
igghlmsghimttaevakilrqiwfkvqdsqlmkyilykgfigidgisltvgevtptrfc
vhlipetlerttlgkkklgarvnieidpqtqavvdtvervlaarenam

SCOP Domain Coordinates for d1i8db2:

Click to download the PDB-style file with coordinates for d1i8db2.
(The format of our PDB-style files is described here.)

Timeline for d1i8db2: