Lineage for d1i8db1 (1i8d B:1-93)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60076Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 60149Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) (S)
  5. 60235Family b.43.4.3: Riboflavin synthase [63783] (1 protein)
  6. 60236Protein Riboflavin synthase [63784] (1 species)
  7. 60237Species Escherichia coli [TaxId:562] [63785] (3 PDB entries)
  8. 60240Domain d1i8db1: 1i8d B:1-93 [61955]

Details for d1i8db1

PDB Entry: 1i8d (more details), 2 Å

PDB Description: crystal structure of riboflavin synthase

SCOP Domain Sequences for d1i8db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i8db1 b.43.4.3 (B:1-93) Riboflavin synthase {Escherichia coli}
mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs
fdlmketlritnlgdlkvgdwvnveraakfsde

SCOP Domain Coordinates for d1i8db1:

Click to download the PDB-style file with coordinates for d1i8db1.
(The format of our PDB-style files is described here.)

Timeline for d1i8db1: