SCOPe 2.08: Domain d1i8db1: 1i8d B:1-93

Lineage for d1i8db1 (1i8d B:1-93)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.3: Riboflavin synthase [63783] (1 protein)
   duplication: consists of two homologous domains
   automatically mapped to Pfam PF00677

6. Protein Riboflavin synthase [63784] (2 species)
   trimerizes via the additional C-terminal helix

7. Species Escherichia coli [TaxId:562] [63785] (4 PDB entries)
   Uniprot P29015 1-87

8. Domain d1i8db1: 1i8d B:1-93 [61955]

Details for d1i8db1

PDB Entry: 1i8d, 2 Å

PDB Description: crystal structure of riboflavin synthase

PDB Compounds: (B:) riboflavin synthase

SCOPe Domain Sequences for d1i8db1:

Sequence; same for both SEQRES and ATOM records:

>d1i8db1 b.43.4.3 (B:1-93) Riboflavin synthase {Escherichia coli [TaxId: 562]}
mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs
fdlmketlritnlgdlkvgdwvnveraakfsde

Timeline for d1i8db1:

• d1i8db1 first appeared in SCOP 1.57
  
• d1i8db1 appears in SCOPe 2.07