![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) ![]() |
![]() | Family b.43.4.3: Riboflavin synthase [63783] (1 protein) duplication: consists of two homologous domains automatically mapped to Pfam PF00677 |
![]() | Protein Riboflavin synthase [63784] (2 species) trimerizes via the additional C-terminal helix |
![]() | Species Escherichia coli [TaxId:562] [63785] (4 PDB entries) Uniprot P29015 1-87 |
![]() | Domain d1i8da2: 1i8d A:94-206 [61954] |
PDB Entry: 1i8d (more details), 2 Å
SCOPe Domain Sequences for d1i8da2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i8da2 b.43.4.3 (A:94-206) Riboflavin synthase {Escherichia coli [TaxId: 562]} igghlmsghimttaevakiltsennrqiwfkvqdsqlmkyilykgfigidgisltvgevt ptrfcvhlipetlerttlgkkklgarvnieidpqtqavvdtvervlaarenam
Timeline for d1i8da2:
![]() Domains from other chains: (mouse over for more information) d1i8db1, d1i8db2, d1i8dc1, d1i8dc2 |