SCOP 1.67: Domain d1i8da2: 1i8d A:94-206

Lineage for d1i8da2 (1i8d A:94-206)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families)

5. Family b.43.4.3: Riboflavin synthase [63783] (1 protein)
   duplication: consists of two homologous domains

6. Protein Riboflavin synthase [63784] (2 species)
   trimerizes via the additional C-terminal helix

7. Species Escherichia coli [TaxId:562] [63785] (3 PDB entries)

8. Domain d1i8da2: 1i8d A:94-206 [61954]

Details for d1i8da2

PDB Entry: 1i8d, 2 Å

PDB Description: crystal structure of riboflavin synthase

SCOP Domain Sequences for d1i8da2:

Sequence; same for both SEQRES and ATOM records:

>d1i8da2 b.43.4.3 (A:94-206) Riboflavin synthase {Escherichia coli}
igghlmsghimttaevakiltsennrqiwfkvqdsqlmkyilykgfigidgisltvgevt
ptrfcvhlipetlerttlgkkklgarvnieidpqtqavvdtvervlaarenam

Timeline for d1i8da2:

• d1i8da2 first appeared in SCOP 1.57
  
• d1i8da2 appears in SCOP 1.65
  
• d1i8da2 appears in SCOP 1.69
  
• d1i8da2 appears in the current release, SCOPe 2.08