Lineage for d1i8da1 (1i8d A:1-93)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 298343Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 298441Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) (S)
  5. 298546Family b.43.4.3: Riboflavin synthase [63783] (1 protein)
    duplication: consists of two homologous domains
  6. 298547Protein Riboflavin synthase [63784] (2 species)
    trimerises via the additional C-terminal helix
  7. 298548Species Escherichia coli [TaxId:562] [63785] (3 PDB entries)
  8. 298549Domain d1i8da1: 1i8d A:1-93 [61953]

Details for d1i8da1

PDB Entry: 1i8d (more details), 2 Å

PDB Description: crystal structure of riboflavin synthase

SCOP Domain Sequences for d1i8da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i8da1 b.43.4.3 (A:1-93) Riboflavin synthase {Escherichia coli}
mftgivqgtaklvsidekpnfrthvvelpdhmldgletgasvahngccltvteingnhvs
fdlmketlritnlgdlkvgdwvnveraakfsde

SCOP Domain Coordinates for d1i8da1:

Click to download the PDB-style file with coordinates for d1i8da1.
(The format of our PDB-style files is described here.)

Timeline for d1i8da1: