Lineage for d1i85b_ (1i85 B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51684Protein CD86 (b7-2), N-terminal domain [63635] (1 species)
  7. 51685Species Human (Homo sapiens) [TaxId:9606] [63636] (1 PDB entry)
  8. 51687Domain d1i85b_: 1i85 B: [61947]
    Other proteins in same PDB: d1i85c_, d1i85d_

Details for d1i85b_

PDB Entry: 1i85 (more details), 3.2 Å

PDB Description: crystal structure of the ctla-4/b7-2 complex

SCOP Domain Sequences for d1i85b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i85b_ b.1.1.1 (B:) CD86 (b7-2), N-terminal domain {Human (Homo sapiens)}
lkiqayfnetadlpcqfansqnqslselvvfwqdqenlvlnevylgkekfdsvhskymgr
tsfdsdswtlrlhnlqikdkglyqciihhkkptgmirihqmnselsvla

SCOP Domain Coordinates for d1i85b_:

Click to download the PDB-style file with coordinates for d1i85b_.
(The format of our PDB-style files is described here.)

Timeline for d1i85b_: