SCOPe 2.08: Domain d1i85a1: 1i85 A:1-109

Lineage for d1i85a1 (1i85 A:1-109)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein CD86 (b7-2), N-terminal domain [63635] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63636] (3 PDB entries)

8. Domain d1i85a1: 1i85 A:1-109 [61946]
   Other proteins in same PDB: d1i85a2, d1i85c_, d1i85d_
   complexed to ctla-4

Details for d1i85a1

PDB Entry: 1i85, 3.2 Å

PDB Description: crystal structure of the ctla-4/b7-2 complex

PDB Compounds: (A:) t lymphocyte activation antigen cd86

SCOPe Domain Sequences for d1i85a1:

Sequence; same for both SEQRES and ATOM records:

>d1i85a1 b.1.1.1 (A:1-109) CD86 (b7-2), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
lkiqayfnetadlpcqfansqnqslselvvfwqdqenlvlnevylgkekfdsvhskymgr
tsfdsdswtlrlhnlqikdkglyqciihhkkptgmirihqmnselsvla

Timeline for d1i85a1:

• d1i85a1 first appeared in SCOP 1.57, called d1i85a_
  
• d1i85a1 was called d1i85a_ in SCOPe 2.07