Lineage for d1i83b_ (1i83 B:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 337215Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 337216Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
  5. 337217Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (1 protein)
  6. 337218Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 337222Species Cow (Bos taurus) [TaxId:9913] [56517] (30 PDB entries)
  8. 337250Domain d1i83b_: 1i83 B: [61939]
    complexed with act, cas, gol, hem, ntu, zn

Details for d1i83b_

PDB Entry: 1i83 (more details), 2 Å

PDB Description: bovine endothelial nitric oxide synthase heme domain complexed with n1,n14-bis((s-methyl)isothioureido)tetradecane (h4b free)

SCOP Domain Sequences for d1i83b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i83b_ d.174.1.1 (B:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus)}
kfprvknwelgsitydtlcaqsqqdgpctprrclgslvlprklqtrpspgpppaeqllsq
ardfinqyyssikrsgsqaheerlqeveaevastgtyhlreselvfgakqawrnaprcvg
riqwgklqvfdardcssaqemftyicnhikyatnrgnlrsaitvfpqrapgrgdfriwns
qlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeapelfvlp
pelvlevplehptlewfaalglrwyalpavsnmlleigglefsaapfsgwymsteigtrn
lcdphryniledvavcmdldtrttsslwkdkaaveinlavlhsfqlakvtivdhhaatvs
fmkhldneqkarggcpadwawivppisgsltpvfhqemvnyilspafryqpdpw

SCOP Domain Coordinates for d1i83b_:

Click to download the PDB-style file with coordinates for d1i83b_.
(The format of our PDB-style files is described here.)

Timeline for d1i83b_: