SCOPe 2.06: Domain d1i82a_: 1i82 A:

Lineage for d1i82a_ (1i82 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.9: CBD9-like [49344] (4 families)
   has additional strand at N-terminus; the active site in a similar topological location as the Cu,Zn SOD site

5. Family b.1.9.2: Family 9 carbohydrate-binding module, CBD9 [63677] (1 protein)
   automatically mapped to Pfam PF06452

6. Protein Xylanase 10A [63678] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [63679] (3 PDB entries)

8. Domain d1i82a_: 1i82 A: [61937]
   CASP4
   complexed with ca

Details for d1i82a_

PDB Entry: 1i82, 1.9 Å

PDB Description: family 9 carbohydrate-binding module from thermotoga maritima xylanase 10a with cellobiose

PDB Compounds: (A:) Endo-1,4-beta-xylanase A

SCOPe Domain Sequences for d1i82a_:

Sequence; same for both SEQRES and ATOM records:

>d1i82a_ b.1.9.2 (A:) Xylanase 10A {Thermotoga maritima [TaxId: 2336]}
mvatakygtpvidgeideiwntteeietkavamgsldknatakvrvlwdenylyvlaivk
dpvlnkdnsnpweqdsveifidennhktgyyedddaqfrvnymneqtfgtggsparfkta
vklieggyiveaaikwktikptpntvigfniqvndanekgqrvgiiswsdptnnswrdps
kfgnlrlik

Timeline for d1i82a_:

• d1i82a_ first appeared in SCOP 1.57
  
• d1i82a_ appears in SCOPe 2.05
  
• d1i82a_ appears in SCOPe 2.07
  
• d1i82a_ appears in the current release, SCOPe 2.08